База данных a-a уголков

Protein PDB codePosition (start-end)Sequence
11a18(16-34)FDDYMKEVGVGFATRKVAG
31a5k(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
41a5l(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
51a5m(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
61a5n(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
71a5o(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
91a76(200-221)LNEVLEDLRISLDDLIDIAIFM
101a77(200-221)LNEVLEDLRISLDDLIDIAIFM
111aa6(264-287)PESVEDITGVSASEIRQAARMYAQ
121adl(16-35)FDDYMKEVGVGFATRKVAGM
131adr(6-28)MGERIRARRKKLKIRQAALGKMV
141ail(30-69)APFLDRLRRDQKSLRGRGSTLGLNIEAATHVGKQIVEKIL
151ala(281-303)LLDIRHEFRKNFAKSLYQMIQKD
201arx(96-127)LTDTIEALRAVGINHGVSFGDLIQFATAVGMS
211ary(96-127)LTDTIEALRAVGINHGVSFGDLIQFATAVGMS
221axn(207-232)PQLKLTFDEYRNISQKDIVDSIKGEL
231axr(105-125)ENACDEATYQLGLDMEELEEI
251b0z(211-235)LLPIAVAGLNIDRMMEGAASAYHKY
261b28(16-43)REVLDLVRKVAEENGMSVNSYIYQLVME
281b56(19-38)FDEYMKELGVGIALRKMGAM
301bj0(27-44)RKLAQKLGIEQPTLYWHV
311bjz(27-44)RKLAQKLGIEQPTLYWHV
321bks(62-91)PTIQNANLRAFAAGVTPAQCFEMLALIREK
341bxg(305-347)SESVVHERAVAIGDTLNQVFEISDNDGVTPDEAARTLAGRRAR
381c9d(61-92)GPTIQNANLRAFAAGVTPAQCFEMLALIREKH
391cmw(626-647)ENLIRVFQEGRDIHTETASWMF
401cp4(149-185)NFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMT
411crx(155-179)IAEIARIRVKDISRTDGGRMLIHIG
421cw2(61-92)GPTIQNANLRAFAAGVTPAQCFEMLALIREKH
431d0x(372-395)KTALNAASTVFGVNPSVLEKALME
441d0y(372-395)KTALNAASTVFGVNPSVLEKALME
451d0z(372-395)KTALNAASTVFGVNPSVLEKALME
461d1c(372-395)KTALNAASTVFGVNPSVLEKALME
471d1l(15-36)GQTKTAKDLGVYQSAINKAIHA
481d4d(445-471)KTIEELAKQIDVPAAELAKTVTAYNGF
491d4e(445-471)KTIEELAKQIDVPAAELAKTVTAYNGF
501dc9(13-33)NYEKFMEKMGINVVKRKLGAH
511dgj(538-569)GAPESEFPSEVLMDELAEKLGMDPFELRALNC
541dze(80-128)WARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIGTGLVGALT
551e2x(33-58)TILPAERELSELIGVTRTTLREVLQR
571ee1(220-235)DETELGISYDEIDDYL
581ei5(154-181)CNGNFRILADLIEAHTGRTLVDILSERI
661els(107-136)ANAILGVSLAASRAAAAEKNVPLYKHLADL
761exd(292-314)PTISGLRRRGYTAASIREFCKRI
801f4l(55-87)HGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAG
841ftq(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
851fty(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
861fu7(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
911fwa(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
921fwb(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
931fwc(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
941fwd(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
951fwe(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
961fwf(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
971fwg(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
981fwh(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
991fwi(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
1001fwj(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
1021fyd(219-236)SDETELGISYDEIDDYLE
1041g5n(200-227)VSHLRRVFDKYMTISGFQIEETIDRETS
1081gdi(88-123)ATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVG
1101gjt(19-45)SLAEAKVLANRELDKYGVSDYYKNLIN
1131gsn(440-461)CDEMLQGFAVAVKMGATKADFD
1181h2s(70-118)APRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMV
1191h68(70-118)APRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMV
1201h9g(33-58)TILPAERELSELIGVTRTTLREVLQR
1221hmr(16-32)FDDYMKSLGVGFATRQV
1281i6k(235-260)KPGISNLLNIYSTLSGQSIEELERQY
1291i6l(235-260)KPGISNLLNIYSTLSGQSIEELERQY
1301i6m(235-260)KPGISNLLNIYSTLSGQSIEELERQY
1321i9d(40-59)SRDELVKLIADMGISVRALL
1341icm(14-33)YEKFMEKMGINVVKRKLGAH
1351icn(14-33)YEKFMEKMGINVVKRKLGAH
1361ie7(31-60)NYPEAVAIITSFIMEGARDGKTVAMLMEEG
1371in7(278-295)GLNALAASLGVEADTLSE
1401iv8(321-346)FSYEV?RLASQLGISYDILRDYLSCI
1421j7k(278-296)GLNALAASLGVEADTLSEV
1431j9b(40-59)SRDELVKLIADMGISVRALL
1441jb9(279-308)MMPGIQDTLKKVAERRGESWDQKLAQLKKN
1451jbg(5-25)VKQVAEISGVSIRTLHHYDNI
1471jfs(3-24)IKDVAKRANVSTTTVSHVINKT
1491jjx(16-35)FDEYMKALGVGFATRQVGNV
1501jp8(82-119)HEAELKPLAQSHATKHKIPIKYLEFISEAIIHVLHSRH
1511jwy(383-406)KTALNAASTVFGVNPSVLEKALME
1521jx2(383-406)KTALNAASTVFGVNPSVLEKALME
1631kqu(1-21)NLVNFHRMIKLTTGKEAALSY
1641kra(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
1651krb(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
1661krc(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
1671ksv(3-24)H?RLDKFIAQQLGVSRAIAGRE
1681l4u(33-52)TDVAIEQRTGRSIADIFATD
1711lib(16-35)FDDYMKEVGVGFATRKVAGM
1721lic(16-35)FDDYMKEVGVGFATRKVAGM
1731lid(16-35)FDDYMKEVGVGFATRKVAGM
1741lie(16-35)FDDYMKEVGVGFATRKVAGM
1751lif(16-35)FDDYMKEVGVGFATRKVAGM
1781llp(87-118)LDEVVAMQKPFVQKHGVTPGDFIAFAGAVALS
1791lpj(15-34)NFEGYMLALGIDFATRKIAK
1831lvk(373-394)TALNAASTVFGVNPSVLEKALM
1841lvl(409-432)AVSELSTAFAQSLEMGACLEDVAG
1881m7g(6-22)TFHASALTRSERTELRN
1891m83(235-260)KPGISNLLNIYSTLSGQSIEELERQY
1911mau(235-260)KPGISNLLNIYSTLSGQSIEELERQY
1921mbc(86-118)LKPLAQSHATKHKIPIKYLEFISEAIIHVLHSR
1971mla(29-50)VEETFAEASAALGYDLWALTQQ
1981mmd(373-394)TALNAASTVFGVNPSVLEKALM
2001mmn(372-394)KTALNAASTVFGVNPSVLEKALM
2071nv9(60-84)VSPTEEKRILELVEKRASGYPLHYI
2081nxg(360-402)PNVDFYSGIILKAMGIPSSMFTVIAAMARTVGWIAHWSEMHSD
2101oe9(354-375)HDPLTIFCDLMGVDYEEMAHWL
2111oep(105-137)GKLGANAILGCSMAISKAAAAAKGVPLYRYLAS
2151ork(27-44)RKLAQKLGIEQPTLYWHV
2171oy6(732-755)DQEKAQALGVSINDINTTLGAAWG
2181oy8(732-755)DQEKAQALGVSINDINTTLGAAWG
2191oy9(732-755)DQEKAQALGVSINDINTTLGAAWG
2201oyd(732-755)DQEKAQALGVSINDINTTLGAAWG
2211oye(732-755)DQEKAQALGVSINDINTTLGAAWG
2231oz9(91-121)QDTAERQARELGHSLEEEVKRLIVHGIVHLL
2241p29(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
2271p43(106-137)GANAILGVSLAASRAAAAEKNVPLYKHLADLS
2281p4g(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
2291p4h(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
2301p6p(13-32)NYENFLRTVGLPEDIIKVAK
2321pfo(189-206)KSQISSALNVNAKVLENS
2331pfu(55-87)GTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGF
2341pfw(55-87)GTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGF
2351pfy(55-87)GTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGF
2361pgo(178-222)AGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEW
2371pgp(178-222)AGHFVKMVHNGIEYGDMQLICEAYHLMKDVLGLGHKEMAKAFEEW
2381phd(149-185)NFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMT
2391phg(149-185)NFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMT
2401pnr(4-23)KDVAKRANVSTTTVSHVINK
2501qax(14-38)SPAARLDHIGQLLGLSHDDVSLLAN
2541qll(1-22)(1-22)SLFELGKMILQETGKNPAKSYG
2551qpz(4-23)KDVAKRANVSTTTVSHVINK
2561qqc(304-345)GLERVARYSMEDAKATYELGKEFFPMEAQLSRLVGQSLWDVS
2571qqt(55-87)GTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGF
2581qru(293-313)ISGLRRRGYTAASIREFCKRI
2591qs1(69-99)DKEKAKEWGKEKEKEWKLTATEKGKMNNFLD
2631r31(14-38)SPAARLDHIGQLLGLSHDDVSLLAN
2661riy(2-38)NKKELIDRVAKKAGAKKKDVKLILDTILETITEALAK
2721rxw(211-233)LESNLKRLGLTREQLIDIAILVG
2731ryk(35-66)KRDQLVGKIQERYGYQKDQAEKEVVDWETRNE
2741s3c(40-59)SRDELVKLIADMGISVRALL
2751s3d(40-59)DELVKLIADMGISVRALLAK
2761s3t(31-60)NYPEAVAIITSFIMEGARDGKTVAMLMEEG
2771s69(80-114)NGEHFDAVAEDLLATLKEMGVPEDLIAEVAAVAGA
2781sd9(40-59)SRDELVKLIADMGISVRALL
2791sij(536-567)GAPQSMFASECLMDMLAEKLGMDPLELRYKNA
2801sjz(40-59)PPSRDELVKLIADMGISVRA
2811sk0(40-59)PPSRDELVKLIADMGISVRA
2821sk2(40-59)SRDELVKLIADMGISVRALL
2841sq8(44-61)RFLPELARALGVAVDWLL
2891t9v(732-755)DQEKAQALGVSINDINTTLGAAWG
2901t9w(732-755)DQEKAQALGVSINDINTTLGAAWG
2911t9x(732-755)DQEKAQALGVSINDINTTLGAAWG
2921t9y(732-752)DQEKAQALGVSINDINTTLGA
2931taq(626-647)ENLIRVFQEGRDIHTETASWMF
2941tc6(170-194)ADPRGNTLGRGTTITLVLKEEASDY
2961tgo(305-346)LERVARYSMEDAKVTYELGKEFFPMEAQLSRLVGQSLWDVSR
2981tmo(296-319)LYDDKFIQGYSLGFEEFVPYVMGT
2991tqh(123-157)SEETMYEGVLEYAREYKKREGKSEEQIEQEMEKFK
3021tuo(347-378)DGILTSLLLLESVAATGKDLAEQFKEVEALTG
3041ty8(244-263)PESCKIECQKLGIDIEMLKS
3101ub2(586-615)RLKNCCLIATQLLGLTAPEMTVLIGGLRVL
3111ubp(32-62)NYPEAVAIITSFIMEGARDGKTVAMLMEEGK
3121ubs(62-91)PTIQNANLRAFAAGVTPAQCFEMLALIREK
3151uok(386-413)IETLNMYKEKVMERGEDIEKVMQSIYIK
3221vlb(536-567)GAPQSMFASECLMDMLAEKLGMDPLELRYKNA
3241vom(373-394)TALNAASTVFGVNPSVLEKALM
3251vyf(15-34)SHNFDAVMSKLGVSWATRQI
3271w0h(183-199)NIARIAVR?LQDGCELR
3281w7i(354-376)HDPLTIFCDLMGVDYEEMAHWLC
3301w9i(372-395)KTALNAASTVFGVNPSVLEKALME
3311w9j(372-395)KTALNAASTVFGVNPSVLEKALME
3331w9l(372-395)KTALNAASTVFGVNPSVLEKALME
3341wpk(101-124)TLEALADQVAMSPFHLHRLFKATT
3391wv0(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
3401wxi(223-239)DEVALGVTYDNIDDYLE
3411wyg(915-946)GGPQGMLIAEYWMSEVAITCGLPAEEVRRKNM
3421xan(440-461)KADFDNTVAIHPTSSEELVTLR
3541yet(115-134)QAGADISMIGQFGVGFYSAY
3551yfe(417-442)GYDKAAEIAKKAHKEGLTLKAAALAL
3581yii(202-226)VSHLRRVFDKYMTISGFQIEETIDR
3611yio(159-185)MNKQIAGELGIAEVTVKVHRHNIMQKL
3641yv3(372-395)KTALNAASTVFGVNPSVLEKALME
3661z05(31-56)GHIDHIKQINAGRVYKLIDQKGPISR
3671z67(71-104)SALGTNAVSDLGQKLGVDTSTASSLLAEQLPKII
3681zcs(536-567)GAPQSMFASECLMDMLAEKLGMDPLELRYKNA
3731zug(19-37)QTELATKAGVKQQSIQLIE
3741zuh(32-51)KLEVLDTDMIISERVGLSVR
3751zui(32-52)KLEVLDTDMIISERVGLSVRE
3772a2d(267-290)CRLAAKLLAKYKSLQWDKVLRLEE
3812aka(372-395)KGAGEGAVLKDKTALNAASTVFGV
3842apg(59-71)FFDFLGIPEREWM
3852aqj(59-71)FFDFLGIPEREWM
3862ar8(59-71)FFDFLGIPEREWM
3912b3t(19-42)SPRRDAEILLEHVTGRGRTFILAF
3962bgq(227-252)ACKKHGIHITAYSPLGSSEKNLAHDP
4002c54(324-355)NMRLKEGLRITYFWIKEQIEKEKAKGSDVSLY
4092cgp(169-192)TRQEIGQIVGCSRETVGRILKMLE
4122cwe(35-60)TISQLSEILGKTPQTIYHHIEKLKEA
4212d0b(158-192)DNPQYNRWQRSGMPQTKMKALLHNRTLVKLVDAIA
4232d2d(243-274)NYEPLTQDHVDILGPLSAQTGIAVLDMCAALK
4252da2(33-63)KDDEFEQLSNLLNLPTRVIVVWFQNARQKAR
4262da7(31-62)NSDELLKISIAVGLPQEFVKEWFEQRKVYQYS
4282dfn(33-52)TDVAIEQRTGRSIADIFATD
4302djn(33-61)ALPERAELAASLGLTQTQVKIWFQNKRSK
4312dt8(119-152)SLGVG??VLRAKELLEEGQSLEAVLAELERLRRD
4332e1c(43-68)PLREISKITGLAESTIHERIRKLRES
4402ei4(85-132)YARYADWLFTTPLLLLDLALLAKVDRVTIGTLIGVDALMIVTGLIGAL
4422euf(220-248)YLEDLSSILNFSTNTVRTVKDQVSEAFSL
4442f1i(155-176)RPERIMQMAEHAGIDGQTVLDN
4462f4q(259-289)SERQAKKVLVDCVKFVADDLGNTPAVTRGSY
4472f8l(3-42)SDKIHHHHHH?ANEATQELFQVLDNTAIILQNELEISYLE
4482f93(70-117)PRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMV
4492f95(70-118)PRYIDWILTTPLIVYFLGLLAGLDSREFGIVITLNTVVMLAGFAGAMVP
4502fbq(27-46)ETSLRLITSKAGVNLAAVNY
4512fet(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
4532ffr(344-371)DLERLDWDKAWEVTVKTCAYTNHTVLPE
4552frf(82-119)HEAELKPLAQSHATKHKIPIKYLEFISDAIIHVLHSKH
4562ft9(13-32)NYEAFLRAVGLPEDIINVAK
4622g1k(33-52)TDVAIEQRTGRSIADIFATD
4642gen(27-46)ATTIE?IRDRSGASIGSLYH
4662gj3(51-68)SILSNGTTPRLVYQALWG
4742h8i(1-22)(1-22)SLFELGKMILQETGKNPAKSYG
4752h8o(222-268)TGALLRFACEAGAIIAGSNQAERQRLRLFGEKIGLSFQLADDLLDLT
4782hl7(38-70)ADSNAPIAADLRKQIYGQLQQGKSDGEIVDYMV
4792hmb(16-32)FDDYMKSLGVGFATRQV
4802hnx(15-36)LVSSENFDDYMKEVGVGFATRK
4822hqd(732-752)DQEKAQALGVSINDINTTLGA
4832hqf(732-753)DQEKAQALGVSINDINTTLGAA
4842hsb(66-93)ECREELGLSDDDCSKLSRAFDLREESDY
4882iai(42-72)VFIERGYDGTS?EHLSKAAGISKSSIYHHVT
4892ict(8-32)RPGDIIQESLDELNVSLREFARA?E
4902id6(25-45)RATTDEIAEKAGVAKGLIFHY
4912iek(25-44)TTDEIAEKAGVAKGLIFHYF
4922imp(82-117)RASEISALIVEEGGKIQQLAEVEVAFTADYIDYMAE
4962iyx(33-53)TDVAIEQRTGRSIADIFATDG
4972iyz(33-53)TDVAIEQRTGRSIADIFATDG
4982izo(209-231)TEILLKKLGITREQLIDIGILIG
4992j0r(20-40)YARDLATLMGISEAELTHSRV
5032jfh(265-296)SGQHNYTNALAALALADAAGLPRASSLKALTT
5042jiq(274-299)RPEKVAEICRVPVEQIYGAARAFAES
5062jj9(372-395)KGAGEGAVLKDKTALNAASTVFGV
5072jkc(59-71)FFDFLGIPEREWM
5092jn3(13-32)NYEEFLKALALPEDLIKMAR
5102jn6(25-48)SLQQIANDLGINRVTLKNWIIKYG
5112jn8(53-84)SPEVVVARGEQEGWNPEFTKKVAGWAEKVASG
5122jt1(27-51)TRDIADAAGLSIYQVRLYLEQLHDV
5132jwt(27-57)YLTERRRQQLSSELGLNEAQIKIWFQNKRAK
5152k9s(33-68)SPSRLSHLFRQQLGISVLSWREDQRISQAKLLLSTT
5162kau(32-62)YPESVALISAFIMEGARDGKSVASLMEEGRH
5172kd1(52-90)TSLHMQNYVNSLRDEGLKRGTIEKIIKVIRNSLEHAIDL
5192myb(86-118)LKPLAQSHATKHKIPIKYLEFISEAIIHVLHSR
5202nap(275-298)PEKVAEICRVPVEQIYGAARAFAE
5312o5r(408-439)SQLKEELQNVRWT?EEITPVFKKVLKQHGVKP
5322o7o(26-45)TRKLAQKLGIEQPTLYWHVK
5382opx(82-117)RATEISALIVEEGGKIQQLAEVEVAFTADYIDYMAE
5392p3z(131-160)SGGLVMNTISCVDLALWDLFGKVVGLPVYK
5402p4q(176-223)CCEWVGPAGAGHYVKMVHNGIEYGDMQLICEAYDIMKRLGGFTDKEIS
5412p6u(477-503)TKLGSLVSRLYIDPLTGFIFHDVLSRM
5432p9b(305-336)GQDVTGITDIQLENSKNVVGG?VSGARQAHEA
5472pgi(211-235)LLPIAVAGLNIDRMMEGAASAYHKY
5502pkn(196-215)VNGAAYLFTNDYEWDLLLSK
5532prj(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
5552ptx(105-137)GKLGANAILGCSMAISKAAAAAKGVPLYRYLAS
5562ptz(105-137)GKLGANAILGCSMAISKAAAAAKGVPLYRYLAS
5572pu0(105-137)GKLGANAILGCSMAISKAAAAAKGVPLYRYLAS
5582pu1(105-137)GKLGANAILGCSMAISKAAAAAKGVPLYRYLAS
5692qhp(243-278)VGAGDSFTAAFCASILNGKSVPEAHKLAVEVSAYVC
5712qiq(250-275)LGPLSAQTGIAVLDMCAALKELLQNG
5772qv2(290-310)FSEYNSVNANMIATLFTSLLL
5792qxf(60-78)QPGAVLITGITPQEARAKG
5832rfp(85-128)VTEVERLVGQGDALTDALYFI?GSFVEAGLEPGPLFEIVQQAN?
5842rha(37-57)ISLSELSLRSGLNSALVKYYF
5872rn7(28-56)SQWATICSIAPKIGCTPETLRVWVRQHER
5902skc(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
5912skd(344-371)LAIPELMRVLVDLERLDWDKAWEVTVKT
5922trt(27-44)RKLAQKLGIEQPTLYWHV
5982vkq(91-126)EVDPVLTVEEKYPYMVEWYTKSHGLLVQQALPKAKL
5992vkv(26-45)TTRKLAQKLGVEQPTLYWHV
6002vl7(468-506)DDMVRKRIERLSKLTGKDEDSIIHDLTAIVIKQTIGRAF
6052vry(85-122)LSSLEEYLTSLGRKHRAVGVRLSSFSTVGESLLYMLEK
6072vwj(304-345)GLERVARYSMEDAKVTYELGKEFFPMEAQLSRLVGQSLWDVS
6102yu3(56-80)SRDVRYKSNLPLTEINKILKNLESK
6152zhg(52-78)DVLRYVAIIKIAQRIGIPLATIGEAFG
6162zj2(480-509)LSLGIRTAKLYIDPYTAKMFKDKMEEVVKD
6172zj8(480-509)LSLGIRTAKLYIDPYTAKMFKDKMEEVVKD
6182zja(480-509)LSLGIRTAKLYIDPYTAKMFKDKMEEVVKD
6212zme(195-219)VSEIKASLKWETERARQVLEHLLKE
6263b7h(49-68)TITTIRKVCGTLGISVHDFF
6323ber(26-42)HDSPTEASQPIVEEEET
6353bng(286-300)VKYSDHKVGNPLDNM
6383bp8(32-57)SRIDLSRLAQLAPASITKIVREMLEA
6403bz7(372-395)KTALNAASTVFGVNPSVLEKALME
6413bz8(372-395)KTALNAASTVFGVNPSVLEKALME
6423bz9(372-395)KTALNAASTVFGVNPSVLEKALME
6513c94(60-78)QPGAVLITGITPQEARAKG
6523c95(60-77)QPGAVLITGITPQEARAK
6553chk(40-67)PPNQLRNMQRTFQAITGTFLDAFLKKHL
6623csv(235-282)VPAQVEAQ?IDHYIQATGVDESHFRSAYAVIAVQRN?RILGIFARLSQ
6633cta(27-52)YLTSSKLADMLGISQQSASRIIIDLE
6643cuy(158-176)GLSTINVASYIEREFDRVA
6713daf(253-301)CSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKG
6723dam(248-275)ATPVMEQAEKLGVPKDEAVHNILFAVCF
6783eau(279-313)RNEGVSSVLLGASNAEQLMENIGAIQVLPKLSSSI
6793eeh(39-55)SAYEDIWGRSVAKLREN
6873f46(253-301)CSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKG
6883f47(253-301)CSAVTATVYAGLLAYRDAVTKILGAPADFAQMMADEALTQIHNLMKEKG
6963ubp(32-62)YPEAVAIITSFIMEGARDGKTVAMLMEEGKH
6974cpp(149-185)NFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMT
6994enl(107-136)ANAILGVSLAASRAAAAEKNVPLYKHLADL
7014ubp(31-60)LNYPEAVAIITSFIMEGARDGKTVAMLMEE
7035enl(107-136)ANAILGVSLAASRAAAAEKNVPLYKHLADL
7066cpp(149-185)NFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMT
7076enl(107-136)ANAILGVSLAASRAAAAEKNVPLYKHLADL
7087cpp(149-185)NFTEDYAEPFPIRIFMLLAGLPEEDIPHLKYLTDQMT
7097enl(107-136)ANAILGVSLAASRAAAAEKNVPLYKHLADL